HORDB

ID: hor000889
Uniprot ID: Q9W6M9(65-117)
Protein name: Galanin message-associated peptide
Gene name: GAL
Organism: Coturnix japonica (Japanese quail) (Coturnix coturnix japonica)
Family: Galanin family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Coturnix (genus), Perdicinae (subfamily), Phasianidae (family), Galliformes (order), Galloanserae (superorder), Neognathae (infraclass), Aves (class), Coelurosauria, Theropoda, Saurischia, Dinosauria, Archosauria, Archelosauria, Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0004966 galanin receptor activity; GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0031764 type 1 galanin receptor binding; GO:0031765 type 2 galanin receptor binding; GO:0031766 type 3 galanin receptor binding
GO BP: GO:0007218 neuropeptide signaling pathway; GO:0045944 positive regulation of transcription by RNA polymerase II
GO CC: GO:0005576 extracellular region

Sequence: EIQPEEDIKAGNIGRPLADENIVRTVVEFLTYLHLKEAGALDNLPSPEETNES
Length: 53(65-117)
Propeptide: MQRCAGFLFLSLILCAALSETFGLVLSAKEKRGWTLNSAGYLLGPHAVDNHRSFNDKHGFTGKREIQPEEDIKAGNIGRPLADENIVRTVVEFLTYLHLKEAGALDNLPSPEETNES
Signal peptide: MQRCAGFLFLSLILCAALS
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: May regulate diverse physiologic functions including contraction of smooth muscle of the gastrointestinal and genitourinary tract, growth hormone and insulin release and adrenal secretion.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor000889_AF2.pdb

hor000889_ESM.pdb

Mass:	680419	Formula:	C257H410N68O89
Absent amino acids:	CMW	Common amino acids:	E
pI:	3.95	Basic residues:	5
Polar residues:	13	Hydrophobic residues:	18
Hydrophobicity:	-54.15	Boman Index:	-10544
Half-Life:	1 hour	Half-Life Yeast:	30 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	97.55
Instability Index:	6653.4	Extinction Coefficient cystines:	1490
Absorbance 280nm:	28.65